General Information

  • ID:  hor002008
  • Uniprot ID:  F5XVF3
  • Protein name:  t-GnRH-6
  • Gene name:  NA
  • Organism:  Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ciona (genus), Cionidae (family), Phlebobranchia (order), Ascidiacea (class), Tunicata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  DPLTNIM
  • Length:  7(81-87)
  • Propeptide:  MKLTFLFVVLMVLYDVTTAQDDVRDVINDEDIDRAIEVLSRLQEEETNPDLTDGDQKMEDTREKYDMEGEVDGNDNKEERDPLTNIMKRFYIKVVRQYCPPGQQCLGFRGRHRWQRCTCPGRTHCQKSPGYGYECL
  • Signal peptide:  MKLTFLFVVLMVLYDVTTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  The sequence shown here is derived from an EMBL/GenBank/DDBJ third party annotation (TPA) entry.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F5XVF3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002008_AF2.pdbhor002008_ESM.pdb

Physical Information

Mass: 91015 Formula: C34H58N8O12S
Absent amino acids: ACEFGHKQRSVWY Common amino acids: DILMNPT
pI: 3.75 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: 12.86 Boman Index: -574
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 111.43
Instability Index: 4987.14 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21467196
  • Title:  Peptidomic Analysis of the Central Nervous System of the Protochordate, Ciona Intestinalis: Homologs and Prototypes of Vertebrate Peptides and Novel Peptides